PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g21762.1.p
Common NameBRADI_1g21762, LOC100832222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 293aa    MW: 31712.3 Da    PI: 9.9356
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g21762.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.81.6e-32144200158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  Bradi1g21762.1.p 144 EEPVFVNAKQYHAILRRRQIRAKLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 200
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.9E-37142203IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.963143203IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.2E-27145200IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-24146168IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860148168IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-24177200IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MLALLRKMED HPGHPISNYD FLSGNGCHTK KLGHKIYDQD SSSTKSGRSQ QEASAMSDSN  60
LNEQHTSRSS AQSDNDDGHG KYNQVMMKSP LSLGNPEAGS SPAKVDYSQS FACMPYTADA  120
YYGGVLTGYA SHAIVPVSAE STAEEPVFVN AKQYHAILRR RQIRAKLEAQ NKLVKGRKPY  180
LHESRHRHAM KRARGSGGRF LNTKQLQEQK QIQASTGGKN TFLQSSPTFA PSASAPSDMS  240
NVSTSSRMLA NHQERACFPS AGFHPMASLG ARSGGDAELA VNGMQQRASM MS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-23144205263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184193RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235752.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
SwissprotQ9LNP68e-38NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLA0A0Q3JTC40.0A0A0Q3JTC4_BRADI; Uncharacterized protein
STRINGMLOC_67781.11e-140(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Representative plantOGRP1192546
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.46e-38nuclear factor Y, subunit A8